PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009755
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 459aa    MW: 48925.6 Da    PI: 8.934
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009755genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.11.1e-14338380547
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                  +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++eN++Lk 
  Lus10009755 338 RRQRRMIKNRESAARSRARKQAYTTELEAEVAKLKEENQQLKR 380
                  79***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-14334397IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.335336381IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.3E-14338381No hitNo description
CDDcd147076.89E-28338383No hitNo description
PfamPF001701.8E-12338381IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.38E-11338382No hitNo description
PROSITE patternPS000360341356IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MGTNWNFKNI TNDSAQPPGN NLALTRQLSS IYSLTFDEFQ SSVGGIGKDF GSMNMDELLK  60
NIWSAEENQN QNHNMAAAAA AAATEDGGVL QRQGSLTLPR TLSQKTVDEV WKDVWKDSGS  120
GSSGVGVGDI GSGRNPQRQQ TLGEITLEEF LVRAGVVREE ITTPVVAAGK VQQPNGVVGV  180
SPFRNNNTTV GYGIGFQQSN EASHAVGLSS GSNNPNYGSN SSLNVNGIIR SNQVPSAATV  240
TGVQPQLQVH QHQPPQIFPK LQGNVGYGGM MGIGDQGLNI QGMAGLGGGS SPASQVSSDG  300
IGKSNGETSS VSPIVPYPYI GGVRGRRANT AVEKVVERRQ RRMIKNRESA ARSRARKQAY  360
TTELEAEVAK LKEENQQLKR KQVIFIHSFM LAVICIDYWG GVGINNVERL GLVGAGRNDG  420
DAEKSGFSLW NGNYCSFLPR TFMNIDITTY GLSLSVVS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012071654.11e-112PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
SwissprotQ9M7Q42e-91AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLA0A067L1G81e-112A0A067L1G8_JATCU; Uncharacterized protein
STRINGPOPTR_0002s12710.11e-107(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF19623481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49720.25e-63abscisic acid responsive element-binding factor 1